DPCstruct | MC26477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 164 ± 20 aa |
| Standard deviation of domain lengths | 20.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0TRQ4 | 2-140 | AAAAVCVVPAQENALQVRMLQNELMVAALTCNQKAAYNGFVMRFKPQLSTEGKHLQSFFSQKYGSRSTKELNGFITRIANESSRRGM… |
| A0A523FMG0 | 29-158 | CMSKAEFRAERVRALQSGLMFAALKCVHKPHLGLQENYNEIMQRYGQDLAKHSTKVQLYFRRTQGPEHRRHLHKYITGMANRYSVIS… |
| A0A317E5E6 | 63-227 | None |
| A0A564WJX7 | 1-154 | None |
| A0A437LZJ5 | 11-159 | None |
| A0A2W7KG78 | 4-160 | None |
| A0A1M3PEV6 | 16-186 | None |
| A0A1Q3J1N3 | 1-158 | None |
| A0A4P7WBW7 | 106-267 | None |
| A0A7W7B3Y7 | 1-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.