DPCstruct | MC2647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 243 ± 63 aa |
| Standard deviation of domain lengths | 62.91 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 66.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6T976 | 163-333 | NHHLPGQYALPPSLPTENYTYAFQEAGFTRRLQRYCLEYTYHLFTDPNADPRENHRVFRLFPCASDRCKTQPRFQQLLKGGISDPLE… |
| A0A5N7BIA5 | 1-203 | MRNDPASKELPRLGCECLKDYQHRKHTHYTYSFQEKDFCRRLQRYSLEYAFRLFTDARSHPLEVYRVFRLVPCIQDRTQMYPYFRRL… |
| A0A0G4MMC2 | 912-1274 | None |
| D4AKA4 | 495-673 | None |
| A0A420YL40 | 448-719 | None |
| A0A401KIE6 | 107-273 | None |
| H0EE83 | 322-615 | None |
| A0A101MI29 | 85-333 | None |
| A0A365NBZ3 | 479-797 | None |
| E5A2I2 | 1-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.