DPCstruct | MC26469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5MQF0 | 271-413 | DPARVEPRGGAVAVPWSEVNEMWEIGTVAQVTDVWTGNIFYVMRRGGWAHADVEPVSFRDTAVMLSNYGGQWSWARRPVVVVIDGRR… |
| C0GGH3 | 202-331 | YGELLDWWTEAQYLWPIGQNARIIDFETGQSFMVRRSYGAFHADVEPLTAEDTRIMQQIWSGWSWRTRPVIVEINGRRLAASANGMP… |
| A0A7X6ZT61 | 1-127 | None |
| A0A6B8RP06 | 299-448 | None |
| A0A7V6LB88 | 968-1117 | None |
| A0A7X9KYX5 | 815-947 | None |
| A0A2N0Z3C9 | 28-165 | None |
| A0A7C6S8N0 | 120-267 | None |
| A0A7C7AC26 | 323-483 | None |
| A0A4Q0VNE5 | 350-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.