DPCstruct | MC26468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 196 ± 40 aa |
| Standard deviation of domain lengths | 40.29 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7D6I8 | 148-282 | LRVALIDAGFALATEVELVDVDRRIGFGTGSDRSLEELKEILWVSGSRFRDPDGAPLTPADRVESAPLGRALLAELDRRGPRTVTEL… |
| A0A3D5MP07 | 12-189 | AAHRFRSHPYLKAIMDAWGIDPGGRNLEDIRKGCRLTLGEFVEYILAFSMADISRRPIYDLFFATDSPKGFIKMKEAMWKVDPSGHF… |
| A0A5P3A4E4 | 24-248 | None |
| A0A7C1Y3D1 | 90-321 | None |
| A0A853QVT9 | 61-308 | None |
| A0A2H9N7S9 | 137-347 | None |
| A0A285SQG4 | 3-160 | None |
| A0A7M5WQE6 | 256-491 | None |
| A0A6L7WLH6 | 1-144 | None |
| A0A7V8VV07 | 21-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.