DPCstruct | MC26467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 240 |
|---|---|
| Mean domain length (aa) | 216 ± 37 aa |
| Standard deviation of domain lengths | 36.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 87.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.89 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19789 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N8I466 | 13-250 | PVGTRLKFGSIFGNPIVMKIANISGNNVTLITDGIIARYAYDAKEPANGDSSRVSYGNNRYVLSNIHQWLNSEAGAGSWYVAQHSVD… |
| A0A3D5IFU8 | 630-838 | GQYLALGRYPQTRDESNCTSIEWLILKREKQRLLIISRNGLDAQPYNNIWNDVTWEKSTLRTWLNSTFYSKAFTSAEQISILTTAVN… |
| A0A1Q6KLH2 | 57-247 | None |
| A0A1H5XKE9 | 266-467 | None |
| K1U331 | 26-301 | None |
| A0A354U410 | 223-508 | None |
| A0A3A9GJV8 | 105-296 | None |
| A0A1H7MXF3 | 57-214 | None |
| A0A1V5DR95 | 39-238 | None |
| R7FC08 | 1-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.