DPCstruct | MC26463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 138 ± 25 aa |
| Standard deviation of domain lengths | 25.24 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 87.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7LML7 | 95-204 | MFSGTIDGSTITGGTIRTAGANADRIELSRNGFNSYNLWGEKNGVSVDSGNFSSLDFYYRGEKRGGLSQAAANISLQSTMGDVIVQA… |
| A0A1R1D3G5 | 1-143 | MTYSDIIAGTVTGALIRTAAAGARFEVDETGWRTYDASGTRRIGIYQDAGYNMSALTFDQSNGTRSGVINGGDGLFEVRSAGDNDLF… |
| A0A1R1BM04 | 486-607 | None |
| V9GHK8 | 1-175 | None |
| M9LGF2 | 53-162 | None |
| A0A7Y4I768 | 326-459 | None |
| A0A7Y6BRR9 | 188-360 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.