DPCstruct | MC26460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 2.86 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 96.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 51.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C7AIN5 | 4-68 | HNKTGYAYGYLTDSAYIINKKTNQEFLITATIHVNKNKIYNDGMYEYDAVGIPFLAALGRQLIRE |
| A0A7J5E7V5 | 262-327 | NKVGLAYGYLTDIAYIVDFENKVEFMLSATIHVNKDRIYNDGIYEYNSIGLPFLSNLGKVIYEYER |
| A0A2T5J5F3 | 42-107 | None |
| A0A7Y0FN36 | 7-70 | None |
| A0A7V3FUE3 | 251-317 | None |
| A0A1I5YI32 | 205-270 | None |
| A0A7C1S1A1 | 317-388 | None |
| A0A354TN88 | 67-130 | None |
| A0A519T8Y8 | 1-62 | None |
| A0A7S2T654 | 108-167 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.