DPCstruct | MC2646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 135 ± 20 aa |
| Standard deviation of domain lengths | 19.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03699 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2R4P5 | 6-131 | ISGRARTVAPFLTLDNDPYLVIADGRLYSEKFVSLERIGGVTYITTEGKDGFVGSRFRNRNYVRNSVKIVIDAYNGNTDIYIFEEDD… |
| A0A4Q2WIW1 | 218-338 | NIKERVPKIAPFLSYDGDPYPVITSQGEIVWLWDAYTVTNMYPYAEPFDNRRNNYIRNSVKLTINAYNGDVNFYVADAKDPIIQTYS… |
| A0A6G3VHD4 | 139-282 | None |
| A0A1I3RIB1 | 2-115 | None |
| A0A336P3K8 | 193-294 | None |
| A0A6L7WS05 | 2-139 | None |
| A0A4D4KB26 | 536-705 | None |
| A0A7G3D6X4 | 2-125 | None |
| A0A497J4D3 | 458-617 | None |
| A0A1D3RPL3 | 295-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.