DPCstruct | MC26457
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1390 |
|---|---|
| Mean domain length (aa) | 388 ± 97 aa |
| Standard deviation of domain lengths | 97.17 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 82.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.36 |
| Pfam Score | 84.59 |
| Assigned Pfam label(s) | PF03381- CL0486- PF03621- CL0219- CL0314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9H8B8 | 76-426 | NLAANCLDRHLATRGDQTAIIWEGDDPDQSKHVTYKQLHHDVCQFANVLKGLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVI… |
| A0A6N7FGK9 | 42-456 | AAALAAAGVRLGDRVAIDLADPLETVIAFLGGLKAGAVVAPLNPRLTPEERDRLVADLAPAHVMREIPTGEADYPAAALDGAAPAIV… |
| A0A814VL66 | 431-841 | None |
| A0A1I8IVH7 | 308-935 | None |
| A0A1I8IM89 | 14-317 | None |
| A0A0K0E2M9 | 319-731 | None |
| A0A6I6Q6P8 | 294-590 | None |
| A0A7K0FHZ0 | 5-341 | None |
| A0A1Q9TE80 | 24-395 | None |
| A0A4Q6GDZ6 | 395-813 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.