DPCstruct | MC26455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 109 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 44.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3ZJE2 | 3-96 | PILVSVSLLVCSNIFMTFAWYAHLKELNNKPWIIAALISWGIALFEYLLQVPANRIGYTVLSVGQLKILQEVITLMVFIPFSVFYLK… |
| A0A6A7KVE3 | 1-111 | MAYLYPIILLSFSNLFMTLAWYGHLKFKAAPLWAAVMVSWLIALAEYWLAVPANRIGIAVYHPSQLKTIQEVITLIVFVGFSYFWLG… |
| A0A7S1NGI2 | 4-102 | None |
| A0A2V9GSU0 | 3-108 | None |
| A0A7S2J424 | 37-150 | None |
| A0A7S4BN92 | 149-267 | None |
| N8VLF2 | 37-148 | None |
| A0A1C3E6R8 | 58-170 | None |
| A0A4Q7YWB2 | 205-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.