DPCstruct | MC26454
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 10.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5BPP2 | 1-86 | MVLPNILITSTPGVEKTTLGKELASRSGLKYINVGNVAREGALYNGYDEEYECPILDEEKVVDELENQMAEGGIIVDYHGCDFLPK |
| A0A170X9T1 | 1-76 | MAVNFPNILIAGTPCTGKSTLSKEVAKRTGMEWIDISDLAIKEKLIQSFDEEFQCPVIDERKVVKFLKPLVKCGGK |
| A0A836CU37 | 1-81 | None |
| A0A0E9NR60 | 129-216 | None |
| A0A7J7LJP3 | 1-66 | None |
| I1BQ81 | 1-62 | None |
| A0A7S3ETX4 | 34-100 | None |
| E5ABL0 | 52-122 | None |
| A0A1B0GMG3 | 4-75 | None |
| A0A814KDM7 | 1-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.