DPCstruct | MC26453
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.11 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q3G9F1 | 3-138 | TVMRFFGIPCRVVTNFSSAHDNNANLIIDRYHSKHGLLENKTKDSIWNFHVWLEGWMRRPDISDNGKYDGWQVLDPTPQELSQGVYC… |
| A0A161N4H4 | 2-99 | INTFDANGELGIHESLWNFHAWIDVWLARPDLPPGYGGWQAVDPTMNIGPSSLEAIKRGEVGYEFDVTEKISEVNADLVDWKEDEKL… |
| A0A6P8GKT3 | 561-700 | None |
| A0A665SXR5 | 869-969 | None |
| A0A6J3EH84 | 21-147 | None |
| A0A0A9Y470 | 2-156 | None |
| A0A5J5CFU0 | 77-181 | None |
| A0A2B4SMY0 | 45-164 | None |
| A0A1S3P7Z2 | 75-215 | None |
| A0A6J2IT09 | 45-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.