DPCstruct | MC2645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 184 ± 16 aa |
| Standard deviation of domain lengths | 16.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 45.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01837 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C0WDT3 | 104-276 | YKTIGLGTRIFLGGGEGYVAWSGTQHNPFAKRTEKGIPVTPAGTMWVMGDLKKMSPDWLVGVSMLGYGCSLAVGLGVPIPLLNEEIA… |
| A0A7C1HX92 | 1-158 | GTQYKTGTETNDYGVPVANSASLALIGDAKAMSTRFIKAAYFEKYGVSMFIGIGIPIPVLDEEMAAGVMIRNDQITTCILDYGDPAK… |
| A0A1V5KSY5 | 20-228 | None |
| A0A3A5HFP7 | 184-381 | None |
| A0A7V0TAY0 | 135-300 | None |
| A0A843G164 | 69-261 | None |
| A0A847YW95 | 23-194 | None |
| Q2JPY7 | 183-384 | None |
| A0A4Q2WRH0 | 18-194 | None |
| A0A7X7KDI4 | 185-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.