DPCstruct | MC26447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 173 ± 11 aa |
| Standard deviation of domain lengths | 11.27 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1IER5 | 139-316 | EISQGLLQDTRRSLAEAREKCLQTESSRHAVLNNRALIEIGLLRKFPGMTTTQALDHFIAKHLLQNPKQRKSRKLRPDCVSVCNQLA… |
| A0A7S0EER0 | 2-193 | EALEADKKAQISALEKAYQTAVSGLQSQLADEKEKRLLLDASMSVVINNRALIEVGILRNTDHISLSQGIEAFVNKFLLKPRQGDSG… |
| A0A7S0LXJ7 | 71-248 | None |
| A0A1Q9EJH3 | 261-433 | None |
| A0A6U4Y6X4 | 12-179 | None |
| A0A812RA09 | 95-268 | None |
| L1IRI6 | 7-158 | None |
| L1J5F6 | 5-159 | None |
| A0A812XIA0 | 864-1041 | None |
| A0A7S0ERN8 | 9-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.