DPCstruct | MC26446
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 288 ± 37 aa |
| Standard deviation of domain lengths | 37.46 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 18.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1I6J3 | 44-357 | QTSPQMLARPGIMRQGKATCYYIDSPANLPGNMQSNFESSIFSRCASIGFHRREKLPADEETRRKLKDSGILTKGYAERVNQVVFAA… |
| A0A7S0EAN9 | 1-341 | PLCEMLSASARGAAAALLVPSLHLRQVHAFLGLSPMPGRCRGLALTKSSKTRRGSQMGKATREWYDSARHLGATGLFESSVFGRFAS… |
| L1IIN2 | 141-477 | None |
| A0A812US04 | 21-237 | None |
| A0A812NRW3 | 26-272 | None |
| L1K1J0 | 277-572 | None |
| L1JDZ7 | 20-309 | None |
| L1J6Q6 | 1-304 | None |
| A0A812ZKT2 | 1-264 | None |
| A0A1Q9EXH3 | 36-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.