DPCstruct | MC26443
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 68 ± 6 aa |
| Standard deviation of domain lengths | 6.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5SM08 | 24-91 | QHLRGLLKAAAIACARLVCHRDTWTFVIEQTSQHPHFRHPDQVSDLNDGQIETILSGRSLLAILVTMR |
| A0A0T6LZN7 | 97-164 | DYERLLRSAAGVAVAEIVCHRDTWAFLVERTATNEHFRLPADIDERPDGTVTVRISGRSLTAAVEALR |
| A0A7K1WAP3 | 196-259 | None |
| A0A150VLC7 | 1-62 | None |
| B4VAY2 | 353-422 | None |
| A0A3Q9KDV0 | 90-148 | None |
| A0A5P2WAU7 | 214-279 | None |
| A0A3R7EW77 | 82-152 | None |
| A0A7K2R0L6 | 2-65 | None |
| M3ECT1 | 48-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.