DPCstruct | MC2644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 165 ± 8 aa |
| Standard deviation of domain lengths | 8.20 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8GCX0 | 2-153 | NGIMAFQNAGGRHLALGANGFYWRCAFHPKAPAAVEVRRGMAGTRTWESQPGEVHLAGTGEPGALWRHSGFAPQKLIGVGFSAMVYD… |
| A0A4R4RV86 | 1-156 | MAASYLGGNGFYWFVGLDPEEGHTIEVRRCGASTRAWESEPGEWHLSTTGDLGGLWRMRGRPPQALLGVGFTAQGQGPGRPYARQPD… |
| A0A2E9RVV8 | 738-902 | None |
| A0A1M3AJ30 | 263-430 | None |
| A0A263DHB0 | 510-682 | None |
| A0A1G8Y7P9 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.