DPCstruct | MC26439
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 130 ± 24 aa |
| Standard deviation of domain lengths | 24.27 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 24.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F2QRM9 | 12-140 | VALAAWLMAPAAAHAQLDHYKCYQGKDLKNPPFQKLKCKDGTGPITSDDFRTNECVDVQKVKFICIPVNKNGEGINDPNTHLICYQI… |
| A0A534QED9 | 211-317 | VPSALNLDHYLCHREARPTPRFLRRAVTLADDYESKTTLVLRPDSLCAPVNEDGGGIKDPTTHLQCYRIRQVGGQTRFAPRSATTTN… |
| A0A534Q6D5 | 361-476 | None |
| A0A7V9P6D8 | 3-108 | None |
| A0A533ZGN7 | 23-145 | None |
| A0A534RJE0 | 160-265 | None |
| A0A534ZJU6 | 1-147 | None |
| A0A534WK96 | 153-291 | None |
| A0A7C5B4C1 | 467-564 | None |
| A0A534UXD8 | 710-809 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.