DPCstruct | MC26436
Metacluster Properties and Pfam Annotations
| Number of structural domains | 100 |
|---|---|
| Mean domain length (aa) | 215 ± 36 aa |
| Standard deviation of domain lengths | 35.89 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.56 |
| Pfam Score | 91.10 |
| Assigned Pfam label(s) | CL0603- CL0063- CL0118- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A446N6W1 | 11-201 | LQRYVAMMDLQERNERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIFRRPQGLYVSLRDKGKVIDVLRNWPERNIQVIVVTDGER… |
| A0A0B1P0S7 | 26-247 | QVRKRLQTYGLTPPIIESHTLQKQRCLKQLASKTLPIEKYIYLSGLRNANTHLFYRLLIDNFTLITPLVYTPVVGEACLRWSEIYRF… |
| A0A6V7U600 | 29-226 | None |
| A0A0R3QVE8 | 437-635 | None |
| A0A817PZA6 | 3-197 | None |
| A0A817QS50 | 388-588 | None |
| A0A453E6P2 | 75-310 | None |
| E6LNL3 | 137-348 | None |
| A0A453E6D2 | 2-194 | None |
| A0A564YJ96 | 38-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.