DPCstruct | MC26435
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 170 ± 17 aa |
| Standard deviation of domain lengths | 16.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 66.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S4PVY6 | 87-253 | SPILPTLAHTSHSPTPVAPPYPPPSTITPPNSIAPIRPIIMTVLPSKRASSQHGVYEHRWNAYLPKEITEIIAVRRRQERAWHVRLS… |
| A0A0B1P0N3 | 1-159 | MSLNQPPLPPSPTATPHQPPPSKTLVNPIVENRPIIKPTPPSKRAAQYEAESEPKNEKNFGHAYLPKELANIIAARQRQERAWHIRL… |
| A0A2S4PX66 | 1-175 | None |
| A0A2S4PVB2 | 1-138 | None |
| A0A2S4PPD8 | 20-183 | None |
| A0A0B1PJ02 | 4-167 | None |
| A0A0B1PH65 | 4-192 | None |
| A0A0B1P978 | 9-195 | None |
| A0A0B1PFM7 | 1-152 | None |
| A0A0B1PDL5 | 1-197 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.