DPCstruct | MC26432
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 121 ± 22 aa |
| Standard deviation of domain lengths | 22.38 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 14.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0132 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5AQM6 | 2-94 | VITNWDGYLMVFPYDEWRIIEEKVSHQSVLKREVRDFQRFFMSGAVDCTFDAQGRVLIPPNLREYAKLEKDIVLAGMIKVVEIWSRE… |
| A0A1H8AVD0 | 5-116 | LLATERNLDMLGRLVLPPLYRKTLGFEKDAVNNKRNYIYMELNIESKEIKLTNANRKPPIDSVQSIKRCFDNWGRLMLPPNFKEKLG… |
| A0A6M6DRC3 | 71-181 | None |
| A0A1I2I9T7 | 51-190 | None |
| A0A291RG11 | 27-146 | None |
| A0A250LLC7 | 2-130 | None |
| A0A523XZF7 | 2-121 | None |
| K0K642 | 5-110 | None |
| A0A386Z924 | 1-90 | None |
| A0A2H0FGA5 | 3-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.