DPCstruct | MC26431
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 177 ± 21 aa |
| Standard deviation of domain lengths | 21.21 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0316 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3EDQ3 | 2-168 | ALFKLGVFSALARARTYGAMIAAGLLVGIPLISLGMARNAATDWAAPDFFFLGSLYNYWGSIPVALGWVGVVMLICQSGALSGLTAR… |
| A0A6M8W9H4 | 493-669 | MLLGVALTKMGVLTGERSARFYAVLAVVGYLIGIPTIIAGILFNESHGFNIVKFAGLGMGFNAVGAVPVMLGHVGLVVFVVKSGLLT… |
| A0A7X9CU04 | 38-252 | None |
| A0A845Q428 | 159-391 | None |
| A0A4R2J1U5 | 11-202 | None |
| A0A812R508 | 573-745 | None |
| Q3EJR9 | 5-180 | None |
| A0A3D1RFU9 | 134-306 | None |
| A0A534GU01 | 235-418 | None |
| A0A4Q2XNY8 | 114-288 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.