DPCstruct | MC26429
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 156 ± 33 aa |
| Standard deviation of domain lengths | 32.82 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 86.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A292YIY8 | 99-244 | YAPACTVQQFEDAYVRAVDHYLLKRFFLYTLSDKLERSDASVPYYSKSILYLVSRGLEAQSGEKPIFGMEIYAKNSPALKRIMDSGK… |
| A0A7Y3E333 | 2-129 | PAGTVDLFTDLVQPFLKAPHPDFRIQEMTIYNLDDELEQDDEVTKAYNKSLLYLVSRAFEEETPEKILGMEKYSKTVERRILPRLTI… |
| A0A285PDV7 | 506-629 | None |
| A0A368XUH3 | 810-964 | None |
| A0A7V5WDU7 | 334-463 | None |
| A0A1S9D1W1 | 1-129 | None |
| A0A5C7W594 | 324-480 | None |
| A0A1F7LWZ4 | 214-374 | None |
| A0A7W1SID3 | 120-297 | None |
| A0A7R7Y2C9 | 713-854 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.