DPCstruct | MC26421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 70.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9WR71 | 24-153 | FSSLHELEGLGRRLCRKSISSEQELKTYERFAVEEYVHDIITELCKLPAARDEFGLGDGIQFSSHTNFLNENEALEADASQVSSVHH… |
| A0A0G2J271 | 10-161 | WNAVPNRFKIYGFPSKHQLEYVVQFITPITSESDLRYYEREAVENQVRKIVDRITEDETLREAFGLRGSITFESHTNLGRAQESSLS… |
| A0A2H3GCV1 | 172-315 | None |
| A0A167NV75 | 205-360 | None |
| A0A4Q7JM35 | 93-259 | None |
| A0A319DP05 | 508-620 | None |
| A0A395HK19 | 88-205 | None |
| A0A0U5C1H0 | 179-335 | None |
| A0A7J6IEC5 | 1-146 | None |
| A0A0A2L4K7 | 100-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.