DPCstruct | MC2642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 10.82 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03613 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660J7T9 | 2-112 | ENTLSKKELRSIWRRWGFTHLSSMSYEKLQAHAWAYSYIPFAEKYYKNDPEAKRRLFLRHSMFYNTEPQTGQLINGIVASLEEKIAL… |
| A0A7V4KPN2 | 3-102 | GAWAAFARLFAVQGAWNHERMQGQGIGWCSVPLLAGLDASARPAAVARAAALFNGHPFLAGVVVGAGARAEVDGAPAAKVERLRTAL… |
| A0A7Z0IPV3 | 257-369 | None |
| A0A485BLW3 | 2-107 | None |
| A0A7C4FE92 | 103-209 | None |
| A0A447S2A8 | 2-105 | None |
| B8B2J4 | 904-1010 | None |
| Q8DR99 | 3-112 | None |
| A0A522BEI4 | 68-172 | None |
| A0A3S4HSG2 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.