DPCstruct | MC26419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 123 ± 23 aa |
| Standard deviation of domain lengths | 23.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 49.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084RIM2 | 1-75 | MSLPAELHLAMSKHLIYPDALSLKHTSRYLYGLVNTGVKLKVAWLVERRSLHLECPNDRRCDLGSDLRFCRGSVP |
| A0A0G2I8C2 | 1-111 | MQRSQVPCSPRPNQQFLHLPTELHVHITSHLPYPDALALKHTNNYFYTLVRTSISLRIDWVIERLTQGLPILWKKCEFRSEVRQTMQ… |
| A0A679NK39 | 7-122 | None |
| A0A1L7TVW6 | 1-148 | None |
| A0A0F4Z103 | 1-132 | None |
| A0A7J6JDD3 | 19-146 | None |
| A0A2H4SVE6 | 11-133 | None |
| A0A545UPQ1 | 1-109 | None |
| F7VMF2 | 3-123 | None |
| A0A093V841 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.