DPCstruct | MC26416
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 239 ± 27 aa |
| Standard deviation of domain lengths | 26.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0314 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6PNI4 | 141-343 | IPAAAHQAAVEIALMAMLGKPLDSVSQVGEHYPQIQELIDACGVESSETQQWSTALRFPDERALQALEYVFNQIGGQTKNQIKSPEN… |
| A0A0G2HNI5 | 2-240 | TLEKATSRVKFYQILHQTMVELLILKDMSKPLTDGCNILGYEDSILSIINQVEVKPSIDFATATLTFPSEEAKATLYEWFSQLYQGI… |
| A0A0C9M312 | 99-303 | None |
| D4ANK2 | 534-771 | None |
| G2XZB0 | 196-482 | None |
| A0A6A6UPH4 | 147-349 | None |
| A0A1L9RPI5 | 140-376 | None |
| K2SEB1 | 96-296 | None |
| H0ES75 | 13-234 | None |
| A0A7D8YNY2 | 76-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.