DPCstruct | MC26410
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 155 ± 29 aa |
| Standard deviation of domain lengths | 29.40 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838RGZ3 | 37-224 | ATSVGLLVLMDVLTNIPIFNGIGSLLVEYGLIVSAFALLLGVLNVLLVHIRKVREQEEGWPYSVVLIGTTIALIIIGVPSGPEGISW… |
| A0A1V5P6U9 | 6-156 | KVHGDRISRKTEGWPYSIILLSGVFITAILGIWKGVDVGTPFDYIFRYFYSPMGSTMFSLLAFFIASAAFRAFRAQSREATMLLVAA… |
| A0A3M0X9F7 | 56-209 | None |
| A0A0S7XET4 | 53-218 | None |
| A0A846QB31 | 1-121 | None |
| A0A660VQU9 | 55-216 | None |
| A0A523YYI8 | 2-171 | None |
| A0A7C6X8H1 | 2-96 | None |
| A0A850B2K9 | 320-504 | None |
| A0A7X9J3M9 | 120-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.