DPCstruct | MC2641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 290 ± 48 aa |
| Standard deviation of domain lengths | 48.33 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.40 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | PF07697- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538TVV9 | 22-332 | PVHWRNLLVRSLLVGALLALAAGLPGASRMRDKYGYREGDIARERIVAPFDFRVIKDETSLRREQQAAASAVPPVFAVDARVSSETL… |
| A0A660J6I5 | 1-288 | MIIQPLRKFRERLGKFYLPVLMFLFFLFSIGIMYTSVKQNNVDYSEGQVAEENIRANKTIENTAATEQKRKLAAEAVPPEYTYQDTL… |
| C6PTZ0 | 10-227 | None |
| A0A7U0M0S1 | 2-305 | None |
| W4QG90 | 23-313 | None |
| A0A6L9ITR0 | 9-311 | None |
| A0A257TM97 | 12-281 | None |
| A0A7X8X5U2 | 1-314 | None |
| A0A511WNF2 | 1-314 | None |
| A0A1G0TIE2 | 6-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.