DPCstruct | MC26405
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 225 ± 30 aa |
| Standard deviation of domain lengths | 29.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2M7ENE6 | 133-324 | SMLELYAVDLGDPARIVTLDTIGGCNLRDALGEDGGPWLIQSRHQNRVQRGLIWSSTPLPHSTRKARIATYRTEWLRLVDQPESDNW… |
| A0A3S3IRI9 | 2-214 | VRWSETSSATEVLPVAKMVLDPRHEHALEQEASGLWRIPERCKGLCLVYLRQGVDVVSRPLPVPRLGSPDAHTGRLVSALTIADYET… |
| A0A1W2FCN2 | 593-807 | None |
| A0A529U627 | 71-282 | None |
| A0A7U7J2M4 | 309-531 | None |
| A0A2M7MYK5 | 1-313 | None |
| A0A290ZSA3 | 626-847 | None |
| A0A4S5JER4 | 154-390 | None |
| A0A411Z1Y3 | 222-416 | None |
| A0A090R8U0 | 24-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.