DPCstruct | MC2640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 15.15 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08960 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N7JM77 | 1-117 | MRTLLGNTFPPAYVRRECNITMISLEQAREILEGGFASFWGHENTVRAVSDYLKMEVPYNRESVRLDDENFPSFDGKSHKEVVVISP… |
| A0A3C1QQ24 | 23-126 | LPVVLLNGPVVTSTGLYRVREVDVEEARRLVRLYGWVSAVGHAATAAVFSRILAVDVPMNRVEYTQQAGQLAIALKLHQRAPEGQVL… |
| A0A7C5WPL2 | 24-130 | None |
| A0A5C5XNR2 | 3-107 | None |
| A0A7Y3UNG6 | 2-146 | None |
| A0A2T1F3F0 | 61-197 | None |
| A0A7C4MKK5 | 1-128 | None |
| A0A842TF55 | 1-118 | None |
| A0A7C5Q1D8 | 451-562 | None |
| A0A3A4ZHU7 | 2-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.