DPCstruct | MC264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 132 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 89.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 23.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V4Z8M0 | 89-216 | HPLASVNELAKEIRRTVDITIAEKREPLLVQALADARIAANFEFIFSEIFQSQIDALRELKVRPKTISEAEQYFETEVIPRNKDLFE… |
| A0A1Y3KRI1 | 2-127 | LELVRKQFEGEKGPDSVELLMQDDAGWRVLWYFENVYSYIFGGQIKLLELLNHRGVVPLDEIRREWDAHKELHKPQLDQLDMDGYLK… |
| A0A520XFA7 | 135-265 | None |
| A0A7L9RSJ2 | 155-283 | None |
| B1KLR6 | 112-242 | None |
| A0A1G1KCD7 | 54-188 | None |
| A0A7U9KHP0 | 24-165 | None |
| A0A258CWP5 | 86-218 | None |
| A0A1H0WZT4 | 92-224 | None |
| A0A1G0ZIX5 | 15-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.