DPCstruct | MC26399
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 138 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401HQT5 | 2-132 | VEGVVDHKAVMRVKGDTSYTILLNRPTDNGSWIIVKDKDYEKFFKGEKNAFISKSIEDEMRKKYFDIKYLVSIRLDSKDPINGIDKG… |
| G0LHB6 | 30-194 | MPSRRSIIASLGALILSGFGAWFWLTSESASGYVQEKSIEARYREENQLHSESIITVTLSNPPGSAPPQLSWLHDDWQNQFDSPTSP… |
| A0A3P3RKN3 | 28-173 | None |
| A0A0S8GN49 | 34-157 | None |
| A0A256HQS2 | 33-171 | None |
| L9W9U9 | 12-135 | None |
| A0A0P7G985 | 1-157 | None |
| A0A2I8VNW0 | 2-136 | None |
| A0A4D6HMK2 | 1-130 | None |
| A0A8A2VHZ5 | 13-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.