DPCstruct | MC26397
Metacluster Properties and Pfam Annotations
| Number of structural domains | 95 |
|---|---|
| Mean domain length (aa) | 271 ± 68 aa |
| Standard deviation of domain lengths | 67.55 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 88.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.11 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0292- CL0328 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A143DB56 | 24-287 | VGMDLAGFKGIFWLEYVHRLVGRLVGVAVVVPLLVFVACRLVDRRVLRRILGLFVLGGLQGALGWFMVASGLIDRPDVSHYRLAAHL… |
| A0A7J2Y7S0 | 4-136 | FRFFAAASLVSTFATIVIGGYVSAAGFGLACPDWPTCKGALVPDLSDPAVLTEWSHRTVAAVTGLLVVITLILAIVWHRQERRLLWP… |
| A0A535B8A2 | 5-211 | None |
| A0A3D3VNE9 | 3-201 | None |
| A0A523KKW2 | 30-289 | None |
| A0A7W1M299 | 22-329 | None |
| A0A2D4PKA8 | 12-207 | None |
| A0A1V9Z703 | 73-411 | None |
| A0A2T2SMA9 | 2-201 | None |
| A0A820YA36 | 316-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.