DPCstruct | MC26396
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 258 ± 52 aa |
| Standard deviation of domain lengths | 51.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 70.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.92 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.26 |
| Pfam Score | 76.61 |
| Assigned Pfam label(s) | PF09429- PF12622 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C4YAF3 | 30-208 | IRGNYSLAREVRKSEQKSRSRIQQKQKHAHLLEKLQRTDPIRLHFQIERLESGQLDGAGKKRLQKLKEHWAFMQKNGLHKEKIQAFL… |
| A0A1E3QCJ4 | 4-245 | EKGLNPAQAQHKRDKANAIKKAKAERSQRMTEKLSKRNPDRISRQIEALKELEQEGRLQGPDRKLLADLEQQLSLVNKAREKVQQGG… |
| A0A0P1A8G4 | 1-272 | None |
| A0A4T0JJK0 | 1-246 | None |
| K3WF71 | 2-245 | None |
| C1FIW7 | 5-271 | None |
| A0A0F7SLN2 | 3-349 | None |
| A0A3F2RR03 | 1-313 | None |
| A0A077RAH5 | 16-314 | None |
| A0A314YUJ2 | 3-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.