DPCstruct | MC26394
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 448 ± 81 aa |
| Standard deviation of domain lengths | 81.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.09 |
| Pfam Score | 75.55 |
| Assigned Pfam label(s) | PF05699- PF12896- CL0448- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S7HTK4 | 2-436 | NRNPLYPLYVKEFPKGLSIHRVADDARIATVVVRDMSQVAGYQWDKATGKFISVFYKDGTARVYDGFRSGRLVSLLRVGDGPVEAGV… |
| A0A1E3Q8N8 | 106-451 | VSGDGDSRIFFNIFGHFSIEYIPLPSSLEKLTPISHASSADLSFHAFIAESQDHSLFILPLRVHFIRRFGNDLAHISSTSTKVQALL… |
| A0A087GFT4 | 27-562 | None |
| A0A1W0A4I6 | 601-1034 | None |
| A0A0G4MXV5 | 311-817 | None |
| A0A165UAT2 | 17-627 | None |
| R7UPI7 | 19-466 | None |
| G4TCW5 | 69-473 | None |
| A0A6S8X0Y2 | 68-517 | None |
| A0A066VMD2 | 49-446 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.