DPCstruct | MC26393
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 136 ± 8 aa |
| Standard deviation of domain lengths | 7.97 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 62.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.32 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 56.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14618 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3Q661 | 1-141 | MSYQYHTYGTPSVSVNSLHHSRAKFDAGRAFDLEDDLEFCPSLLSEEEIQSATTYSSDRSSTSGSPESSPLQTQVRPSTSSMLGQLS… |
| F2PV30 | 65-194 | GSRQFRGVKSMRDLVEAPAITAFRARFEAGRSFDLDDDLEFCPNLLTEDDLQSIHSLAASDRSSLGSASPDSSPLQHQVHPMQQHHI… |
| D4AT61 | 222-353 | None |
| F2SGG6 | 112-245 | None |
| A0A1B8F622 | 31-167 | None |
| A0A3N4LNL8 | 1-138 | None |
| A0A397GCM9 | 1-148 | None |
| A0A3F3PNH4 | 1-148 | None |
| A0A022XK98 | 116-245 | None |
| A0A642VAN8 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.