DPCstruct | MC26392
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 250 ± 51 aa |
| Standard deviation of domain lengths | 51.49 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 71.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 21.51 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | PF04696- PF04697 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3Q631 | 35-265 | RERSESRTPSPSRSISRPLVDENTQPAEHHGSAVTEQPKRIRRNPSLAAAEEKGRNKRMFGMLLTSLGKFQEETSRSHITSKREEVE… |
| M7PMW1 | 5-189 | VVVESMVFLPEQERLRDQEESSQRRDRRQRMGLDEQKRGQRFLGTLMGTLGKFQKESVFLQEKNAKRAEIEARLAECMRKEKEALEE… |
| A0A5D6Y845 | 3-310 | None |
| A0A370TGY2 | 45-325 | None |
| A0A401KVZ2 | 772-942 | None |
| A0A0D6QX58 | 1-276 | None |
| A0A0D2MDF4 | 49-403 | None |
| A0A438N2P0 | 8-238 | None |
| Q4N6H7 | 1-226 | None |
| U6LAQ9 | 33-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.