DPCstruct | MC26390
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.02 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0617 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X4JQE0 | 299-398 | GCAGVEQAAQNAGHDVQVPFAPGRTDATEEWTDAESFDVLEPTADGFRNYLQAGQEGTAEELLVERAYMLTLTAPEMAVLVGGMRVL… |
| A0A0D1HZD6 | 34-124 | GGNTAVEQAADRAGQRVSVPFTPGRVDALQTQTDVASFAFLEPKADGFRNYYSARADLGPAESLVDKADSLGLTVAEMTVLVGGMRS… |
| A0A1G1T433 | 2-90 | None |
| A0A485BGG9 | 61-153 | None |
| A0A7K1AMW2 | 387-487 | None |
| A0A4V3HWL9 | 566-658 | None |
| A0A6G3VHS7 | 2-92 | None |
| A0A1D3RPC2 | 327-453 | None |
| A6TV07 | 220-324 | None |
| A0A7K0Y628 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.