DPCstruct | MC2639
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 58 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 49.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9GUD1 | 25-80 | NGKPAGVRCIHLSADGLCALFGKSERPAVCLGFRAEKEVCGNNREEAVSIISGLEG |
| A0A4R1LVD9 | 21-82 | MTQGKPAGVRCVQLTEDNRCGIFGQPERPACCAGLQASIEMCGTTREQAISWITELEQATAP |
| A0A290TA46 | 2-58 | None |
| A0A6J5CZ36 | 4-64 | None |
| A0A4V3CTL3 | 8-66 | None |
| A0A480AV92 | 4-63 | None |
| H8GQJ2 | 26-82 | None |
| A0A090RY58 | 1-52 | None |
| A0A178LRJ4 | 4-63 | None |
| A0A402AY13 | 1-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.