DPCstruct | MC26388
Metacluster Properties and Pfam Annotations
| Number of structural domains | 187 |
|---|---|
| Mean domain length (aa) | 149 ± 22 aa |
| Standard deviation of domain lengths | 22.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.54 |
| Pfam Score | 76.77 |
| Assigned Pfam label(s) | CL0771- PF17884 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1HW98 | 3-121 | PKTIVLVTCVKPKRNQKSAAKDLYQGELFEQLMNYAHSLNPDQIFILSGKHHLLHLETEIEPYDLNLNHQSEEALIAWSNKVLQQLA… |
| A0A1Z4UHR6 | 10-157 | NTANTRSLLIIGCSQRKRSDPGLLPAIIRYDGPSFLVLRRFLRQCPSKLPPINVCILSAEFGLISQHHLIPYYDRRMTATRAQQLRS… |
| A0A6L9J4B1 | 211-366 | None |
| A0A0F9UCH5 | 79-273 | None |
| A0A3M9ZJI2 | 96-237 | None |
| A0A662V8J9 | 395-540 | None |
| A0A7J2MMR5 | 133-289 | None |
| A0A662VA88 | 1-133 | None |
| A0A534KS88 | 141-272 | None |
| A0A2N4UWF7 | 2-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.