DPCstruct | MC26387
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 118 ± 5 aa |
| Standard deviation of domain lengths | 4.71 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 32.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A412HGB8 | 404-521 | YPFICLPIMETPIMPYRIQKRVYNRGIQEDSFEKMLSRFIKDPYEVKSDIGLVNDIDLCYEPDIAIVHQGHPHVHIDIEIDEPYSVN… |
| A0A1Y4GM62 | 117-234 | FPIIRVPQRGCEIKLPVLGRSGKRGVCEERLCKIIKDLKLHGFYDSLSLFIGNYSKPFEPDIAYIDTQKGIFVDIEIDEPYSGWERK… |
| A0A3C0CG65 | 170-289 | None |
| A0A1H3Y5M7 | 5-121 | None |
| A0A543EHJ8 | 1-117 | None |
| A0A098BXL1 | 156-277 | None |
| A0A4Z0PXA3 | 178-299 | None |
| A0A7C3PQS4 | 7-137 | None |
| A0A0S3U2H0 | 1-117 | None |
| S7WZB1 | 28-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.