DPCstruct | MC26383
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 95 ± 10 aa |
| Standard deviation of domain lengths | 10.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0359 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9CUV1 | 64-158 | LTALGRQVRHWRLHRRSNVTLADLARTINPIVRGWMAYYGAFYRSALSVLLTRINSYLVRWIRKKYKRLRPMRKASAAWQRAVTGSP… |
| A0A0D8HL87 | 6-108 | AISNKAKKAIRATTRGWHLNRWSSLELEDIALSIDPVVRGWVNYYGAFYASKLRFIASNIDRHLVLWLMQKYKRLRARPRKAWEVLA… |
| A0A7X1TLP4 | 209-309 | None |
| A0A380CZI6 | 30-127 | None |
| C3BU30 | 195-298 | None |
| A0A7X0GUW6 | 242-327 | None |
| A0A6N1YEQ8 | 140-245 | None |
| A0A5E8V3U8 | 154-259 | None |
| A0A543C9E7 | 37-132 | None |
| A0A1F3VJR9 | 211-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.