DPCstruct | MC2638
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 9.68 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 44.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P2JLV6 | 4-78 | ISKLPLPNSFVEFLEANGLDPSIYTTIHSTPRYIRLKPGSEAHLEEIEAEINCKLQKVGWLPGFYSLPPHVQIAN |
| A0A4D8ZBL2 | 1-91 | MEVVPGASEFPLPESFLEFLNQNGLDPSIYAASHSTPRYIRLKPGCKLEREEIEDEIKCRLEEVYWLPDFYYLPPDVRICCMHDHSC… |
| A0A6L2P2S6 | 1-92 | None |
| A0A453S057 | 13-117 | None |
| A0A507CY55 | 8-95 | None |
| A0A1Y2GBJ7 | 27-127 | None |
| A0A4Y7IAS6 | 1-96 | None |
| A0A7J7E3E4 | 1-80 | None |
| A0A453S051 | 6-92 | None |
| A0A5N6NFE4 | 4-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.