DPCstruct | MC26377
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 92 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A285RES9 | 124-207 | DESCQSLVDNEDTSFVSIEYNDDVTEFTCVMTNTEPNLSESFSVISIYLLGAYYNTFAGESDFDVKVQYVNEESGETVYEGSYQ |
| A0A0M2H357 | 2-93 | LSSAQDAADELIADDTNSVTGVEFNDAMTPVNVSVDAAKYGALESSLALGFYVQGALYQQINGVAPDDIDVIVEFVDEATGEVLDTG… |
| R6P9R0 | 122-215 | None |
| A0A1Q9JPA1 | 1-100 | None |
| A0A7W0D675 | 73-168 | None |
| H5XUF8 | 100-187 | None |
| A0A645C578 | 24-117 | None |
| A0A1G6I5M2 | 107-198 | None |
| A0A852UFE3 | 1-84 | None |
| A0A396N454 | 2-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.