DPCstruct | MC26371
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 166 ± 15 aa |
| Standard deviation of domain lengths | 15.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L0KS08 | 3-136 | LQHWLGRATHAIQDWADTFGPYEAHPSLQVDDDRFADAFALFTGRLRDNYPFFHPNYAGQMLKPPHPAAVVGYLTAMLINPNNHALD… |
| Q0CZA7 | 26-182 | FKENIDTILQSVLTARRNYYPNDKVFITPHIKNSEASKTATEKLAYIVEQTANKSGDGSIPYWHPRYQGHMCMELTMPAVLGYFMTM… |
| A0A4S8KL41 | 2-164 | None |
| A0A379GIL4 | 4-172 | None |
| B8FAM3 | 16-182 | None |
| A0A1J9RPZ9 | 7-178 | None |
| A0A353RY90 | 2-183 | None |
| A0A2I2GMI9 | 4-176 | None |
| A0A0K6G9Z7 | 46-224 | None |
| A0A2N1M004 | 9-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.