DPCstruct | MC2637
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 113 ± 18 aa |
| Standard deviation of domain lengths | 17.77 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 45.29 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0220- CL0091 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D8Z795 | 7-125 | TCVGCDSQPAKIFGRTKSATAQALTGLKFITKTGGAATWTDVETRFYRLTPLTNGLLPRALFGECIGVKESSQFDGELFDVLARKRN… |
| A0A2K3L6X2 | 119-227 | DKVDRSKSAAARALQGLKFMTKNVGTDHGWSQVEKRFDELSLDGKLPKTRFSQCIGMHESKEFASELFDALARRRGIKAASITKEEL… |
| A0A022RKD6 | 181-280 | None |
| A0A446J927 | 190-296 | None |
| M8ABG8 | 14-126 | None |
| A0A803LCR7 | 32-118 | None |
| A0A803LCR9 | 63-142 | None |
| A0A445EF29 | 19-171 | None |
| A0A835FQU6 | 30-116 | None |
| A0A2Z6NJM5 | 106-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.