DPCstruct | MC26368
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 115 ± 15 aa |
| Standard deviation of domain lengths | 14.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z0Z071 | 235-357 | DSVIEAWTTALTAVDHLVQGIPQRITNGATLLAISSWHLYPDMHILASEVKSISQRDELMVGATLTLSTVSSDEGQAGVFWSLPLSR… |
| A0A5M8PXJ5 | 68-180 | WITTLKTIDKLIEGMPHSIQNGAVLLGLSVWHLYPDMVVLGDTMKKIEQNDNLMDKRGILTLGLSMKDRSVSDSHETMSDGVYWSLP… |
| A0A5Q3DTL0 | 239-336 | None |
| A0A1L7WEG2 | 234-339 | None |
| A0A175W0R0 | 107-215 | None |
| W6XVL2 | 1-134 | None |
| A0A1B8B9U2 | 29-144 | None |
| A0A4Q4Y9D3 | 233-365 | None |
| A0A178ZJT4 | 2-115 | None |
| A0A5N6XYM9 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.