DPCstruct | MC26365
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6PJ08 | 4-88 | TFTERLLRLDQDERRKEYRRQDFVPLEKIPSWRQENRFNEEEEEPELTGEGGGLSDKVSLYKGDITVLEVDAIVNAGKGLTSFFW |
| A0A498N1A7 | 9-90 | LDSESSDWKEAKKKLCSMDKEKRREVYRVDFIPLEKIPVWSPSGVSSREPRYKVNEELNKKISLFTGDITKLEIDAIANADF |
| A0A4W5RJJ2 | 154-236 | None |
| S7MT25 | 2-102 | None |
| A0A402FBQ5 | 7-91 | None |
| A0A653DQ97 | 35-123 | None |
| A0A556TNK4 | 101-189 | None |
| A0A498LSB8 | 8-88 | None |
| A0A835P064 | 4-91 | None |
| A0A6I8PFJ0 | 76-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.