DPCstruct | MC2636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 228 ± 36 aa |
| Standard deviation of domain lengths | 35.65 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 60.46 |
| Pfam Score | 94.44 |
| Assigned Pfam label(s) | PF08082- PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1CAH6 | 5-182 | PKSNMSIEAREWQQLQSKKFSEKRKFGFVEAQKEEMPPEHVRKIVRDHGDMTNRKFRHDKRVYLGALKYMPHAVLKLLENMPMPWEQ… |
| A0A4D8YSJ2 | 1-288 | MDVVEEDPRHEDFFPSLAAISISTSMNHRNFNSGQDMWSNTNNPAPPGTSGAGAIPPMMAPPGTSGAQPPMLPPSYSVVPTESQLDE… |
| K0TGJ8 | 190-472 | None |
| B8C3V5 | 414-677 | None |
| A0A0B1SPH7 | 1-200 | None |
| A0A512UK03 | 4-275 | None |
| D2V0Z6 | 1-253 | None |
| A0A0G4KG05 | 1-224 | None |
| A0A2P8XJP4 | 65-259 | None |
| A0A7J8GF97 | 2-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.